DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIb and beat-Ib

DIOPT Version :9

Sequence 1:NP_650613.2 Gene:beat-IIb / 42082 FlyBaseID:FBgn0038494 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster


Alignment Length:280 Identity:97/280 - (34%)
Similarity:142/280 - (50%) Gaps:63/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LRDVNLLVEPPAVRRGQSVALRCDYQLVEAPLYSIKFYRGQMEFYRYTPGEYPPTKVF-QFPGIR 159
            ||:||:.: |.||:||.:..|.|:|.:....||::|:|||:.|||||||.|.|..|:| :...|.
  Fly    29 LRNVNVRI-PSAVKRGDNALLICNYDIENDTLYTVKWYRGRREFYRYTPKENPAWKIFTKTNEID 92

  Fly   160 VDENGSNATTVLIRNVSFGLSGQFSCEVTADAPLYSTATAFAQMQVVEFPEKRPQLFTEHSRYEP 224
            |:...|||:.||:|||...:||:|:|||:||||.:.|:...|.|:|||.|.:||.:...||||..
  Fly    93 VETAQSNASHVLLRNVPTSISGKFACEVSADAPTFDTSIVAADMEVVELPTQRPIITGIHSRYRL 157

  Fly   225 GDVLRANCSTLPSRPRADLRFTINNIPVSIPFTEETQYIRTVD-------SLIASRLSLKLQLQA 282
            |||:..|||:..|:|.|:|.:.||:|.|      ...|:|..|       .|.::.|.:|..:..
  Fly   158 GDVINGNCSSDYSKPAANLTWWINDIQV------PPNYLRIYDIQRHVAEHLESAVLEIKFVVTV 216

  Fly   283 THFVAGLSAHGNGNGNGNGNGNGNGNGLANALHLGGGGGGAGGGGLILRCTAQIGDLYQEYKE-- 345
            .||:.                                      ..|.|:|:|:|.::|.:..|  
  Fly   217 HHFIK--------------------------------------SRLKLKCSARIHEIYAQESEKL 243

  Fly   346 IELGTPQKDPVPARVTLSSG 365
            ||...|:        .|:||
  Fly   244 IEEDRPR--------ILASG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIbNP_650613.2 IG_like 108..198 CDD:214653 44/90 (49%)
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.