DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur89F and CG7017

DIOPT Version :9

Sequence 1:NP_001262662.1 Gene:Mur89F / 42080 FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster


Alignment Length:273 Identity:57/273 - (20%)
Similarity:92/273 - (33%) Gaps:58/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1344 PNNCSKFYRCVRN----NKGGFTSIPFQCGAGTVWDQDLQTCNHNFNNCSTGTESTTPKPPCEPA 1404
            ||.|..:.||..|    .:||       |.||..::::|       ..|...:.|....|..:..
  Fly    45 PNTCDNWVRCASNYSVLEQGG-------CAAGLNYNKEL-------GRCILASSSAAVCPYADSI 95

  Fly  1405 TNGTT---ATSTSSTTTPPPTTTD----LPPTSTTGLPPTTTTEL--PPTTTTDL------PPTT 1454
            .:..|   |..|.......|:::|    :...|...:......||  .|.:.:.:      .|.:
  Fly    96 ADKATNLCANETEGAFIVDPSSSDCRGYILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPIS 160

  Fly  1455 TTRLPPTTTTSLPPTTTTGLP-----------PTTTTGAQPTTTTLSSE----TETSTVTTSPES 1504
            .|:.......|||..|....|           ....:.|.|..:...:.    .:.:.|:....:
  Fly   161 QTKKTSPACRSLPNNTRLADPVHCDQYYECVSEVLHSRACPVASAYDANLGYCVDVAEVSCYESA 225

  Fly  1505 TTQPPSTTTMKPLPAGTECTGEGYMADPEDCRKYYRCINAGASYRKY-----NFTCPKGTGWNEE 1564
            ....|..|..  |.:.|.....||.||.|.|..||.|.:..|.  |:     :.:||.|..::.|
  Fly   226 ALPEPENTFC--LDSATGSARVGYFADDESCSHYYICGSPVAG--KHDTEPKHLSCPLGQYFDFE 286

  Fly  1565 VQTCDYVENIPRC 1577
            ..:|....|: ||
  Fly   287 KLSCRDRLNV-RC 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884 12/47 (26%)
CBM_14 1523..1577 CDD:279884 17/58 (29%)
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 8/51 (16%)
ChtBD2 246..290 CDD:214696 15/45 (33%)
CBM_14 303..348 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.