DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur89F and CG5897

DIOPT Version :9

Sequence 1:NP_001262662.1 Gene:Mur89F / 42080 FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:224 Identity:55/224 - (24%)
Similarity:81/224 - (36%) Gaps:50/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FGFCIGAAAARDIRSPMDQTDVAFYCPGEGLFADDYDCRIYYRC------ERRSGQYIQPYLLAC 90
            |..|:..|...:||. ....|......|.|...|..||:.:..|      :|||          |
  Fly     8 FHLCVILAIVAEIRG-FSMEDKCKLWAGTGYIGDPSDCQAWGYCQDNKLIDRRS----------C 61

  Fly    91 PEDAVFSRTLRMCLPPAMSGRDECVDQVNEVDGDSMEKWEQDDYGQDDHNAMLNLAVTPAANELR 155
            .|..::|.....|   ..:....|..|::|:.. |:|.|              |....||  :.|
  Fly    62 TEGLLYSFRDGTC---KRASDTICHSQLSEICA-SLEPW--------------NYVANPA--DCR 106

  Fly   156 TYASTHRL--PTNYGLAGLNGVSVISFSSSSSLRAVGSAEEDGIIC---RDDGFMTDPSDCTVFY 215
            .:.....|  || :|..|:.  .|.|....:.|..|....:|. ||   :|..|:.||..|.::|
  Fly   107 RFVKCADLDDPT-WGDCGVG--QVFSNKKQTCLEEVAGCPQDN-ICSHMKDGSFVGDPKSCQIYY 167

  Fly   216 RCISNGRGYNKIGFRCSDGTAWDESLQSC 244
            :| .||.|   ....||.|..::....:|
  Fly   168 KC-HNGFG---TMLNCSVGRYFNRKTGNC 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884 13/54 (24%)
CBM_14 200..250 CDD:279884 14/45 (31%)
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 15/50 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.