DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur89F and CG32302

DIOPT Version :9

Sequence 1:NP_001262662.1 Gene:Mur89F / 42080 FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:341 Identity:71/341 - (20%)
Similarity:99/341 - (29%) Gaps:132/341 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1799 PEPQPNYNCSSEGFFPDPEDCSRYYRCVDAAKNGKYQVYAFKCGKGTVWDTSTETCNYADQVSGN 1863
            |:..| ::|...|.||||.||.||:.|.|.:.:...     .|..|..:.|.|.|| ...:.|..
  Fly    86 PKRGP-FSCQQAGLFPDPYDCRRYHECSDQSVDTPR-----ICSNGAGYSTLTGTC-VLPRESEQ 143

  Fly  1864 CSSGQTTTPGTTTEPGTTESTTSSGKPETTSKAPENTTTWAPETTTTSSPETTTTVASETTTTTS 1928
            |               ..|..|.|...:....||:|...:.....|.:|.........|.....|
  Fly   144 C---------------IQEQFTCSRSGQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFNS 193

  Fly  1929 GTTTTATPETTTKPPKPETTTIAGEETSTSKSPTTTESPAPSTNTSAPCP---------ETGPGQ 1984
               .:..|                 :|.:.:|....||.....|....||         :...|:
  Fly   194 ---YSCVP-----------------DTRSMRSIQAMESHTCMNNDRYQCPFRTSEIEYCKCVDGE 238

  Fly  1985 -NVYVCPTGFRRHPE--KC--GMFYQCSESADNNDLNIVVFQCPNGTVYQDKSCSCGKPPAGDKC 2044
             .|..||.||:..|:  .|  ...||||:        ..:..|||                    
  Fly   239 LEVMTCPAGFQIDPKILTCVTDRIYQCSD--------FEILSCPN-------------------- 275

  Fly  2045 SKDMKRTTNAFEEETKLQNVVQISTTDPLCPDEGHFALNNDQCGQLFVKCGFSELTGRIEGQIHR 2109
                                  :||.|..|....|         ||               ||:.
  Fly   276 ----------------------VSTKDEYCICIDH---------QL---------------QIYS 294

  Fly  2110 CPQGFAYWNV-SRRCE 2124
            ||.| .|:|. :|:|:
  Fly   295 CPMG-QYFNAETRKCQ 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884 17/51 (33%)
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.