DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur89F and CG34324

DIOPT Version :10

Sequence 1:NP_001262662.1 Gene:Mur89F / 42080 FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:330 Identity:86/330 - (26%)
Similarity:111/330 - (33%) Gaps:111/330 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1266 PPTTSTPTTSRPTTASTSRPSDQTSTSRPTGPPTTARPVTARPTTSSPTTASSSQTTSPVTQAPN 1330
            ||...||..:.|       |...|:|:.|..||.|.  .|..|....|.|.    ||.|..:.| 
  Fly    26 PPRADTPPCTPP-------PDPCTTTTCPPPPPCTT--TTCPPPEPPPCTT----TTCPPPEPP- 76

  Fly  1331 TDGKCRSEGFMADPNNCSKFYRCVRNNKGGFTSIPFQCGAGTVWDQDLQTCNHNFNNCSTGTEST 1395
                                                                    .|:| |...
  Fly    77 --------------------------------------------------------PCTT-TTCP 84

  Fly  1396 TPKPPCEPATNGTTATSTSSTTTPPPTTTDLPPTSTTGLPPTTTTELPPTTTTDLPPTTTTRLPP 1460
            .|.|||          .|::...|||.....||...|..||..|...||.|.|   |...||.||
  Fly    85 PPPPPC----------ITTTCPPPPPPPPPPPPPPCTRTPPPCTRTPPPCTRT---PPPCTRTPP 136

  Fly  1461 TTTTSLPPTTTTGLPPTTTTG--AQPTTTTLSSETETSTVTTSPESTTQPPSTTTMKPLP----- 1518
            ..|.:.||.|.|  ||.|||.  ..|.|||   :..|:||.|:|:|....|.....:..|     
  Fly   137 PCTRTPPPCTRT--PPCTTTPPCTPPCTTT---KPCTTTVCTTPKSDNAGPIVDGNEEQPDIDNP 196

  Fly  1519 --------AGTECTGE---GYMADPEDCRKYYRCINAGASYRKYNFTCPKGTGWNEEVQTCDYVE 1572
                    :..:|.|:   .::||...||:||.| |...|.|:   .||.|..::.|::.|....
  Fly   197 VAIAQVLISRHDCRGQEDGTFLADVRHCRRYYVC-NRQRSKRQ---NCPNGYWFDRELKACRLAS 257

  Fly  1573 NIPRC 1577
            .:..|
  Fly   258 TVNNC 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur89FNP_001262662.1 CBM_14 57..106 CDD:426342
CBM_14 200..246 CDD:426342
CBM_14 484..536 CDD:426342
CBM_14 745..798 CDD:426342
CBM_14 1025..1075 CDD:426342
CBM_14 1206..1261 CDD:426342
CBM_14 1336..1387 CDD:426342 0/50 (0%)
CBM_14 1523..1577 CDD:426342 17/56 (30%)
PTZ00449 <1574..1800 CDD:185628 1/4 (25%)
CBM_14 1809..1861 CDD:426342
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342 17/56 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.