Sequence 1: | NP_001262662.1 | Gene: | Mur89F / 42080 | FlyBaseID: | FBgn0038492 | Length: | 2159 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_490942.1 | Gene: | ule-1 / 171778 | WormBaseID: | WBGene00021005 | Length: | 235 | Species: | Caenorhabditis elegans |
Alignment Length: | 247 | Identity: | 64/247 - (25%) |
---|---|---|---|
Similarity: | 83/247 - (33%) | Gaps: | 79/247 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 1213 GDRS---DCAKFYRCVDNDRGGFNMVPFSCGPGTVWDAQMQACNHAWAVKECGGIAPPTTST--- 1271
Fly 1272 --PTTSRPTTASTSRP-----------------SDQTSTSRPTGPP----------TTARPVTAR 1307
Fly 1308 PTTSSPTTASSSQTTSPVTQAPNTDGKCRS----EGFMADPNNCSKFYRCVRNNKGGFTSIPFQC 1368
Fly 1369 GAGTVWDQDLQTCNHNFNNCSTGTESTTPKPPCEPATNGTTATSTSSTTTPP 1420 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mur89F | NP_001262662.1 | CBM_14 | 57..106 | CDD:279884 | |
CBM_14 | 200..250 | CDD:279884 | |||
CBM_14 | 484..536 | CDD:279884 | |||
CBM_14 | 745..798 | CDD:279884 | |||
CBM_14 | 1025..1074 | CDD:279884 | |||
CBM_14 | 1206..1261 | CDD:279884 | 12/50 (24%) | ||
CBM_14 | 1336..1388 | CDD:279884 | 20/55 (36%) | ||
CBM_14 | 1523..1577 | CDD:279884 | |||
VAD1-2 | <1599..>1656 | CDD:291956 | |||
CBM_14 | 1809..1861 | CDD:279884 | |||
ule-1 | NP_490942.1 | ChtBD2 | <30..61 | CDD:214696 | 9/35 (26%) |
ChtBD2 | 159..204 | CDD:214696 | 18/49 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0016757 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |