DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5292 and C08E8.4

DIOPT Version :10

Sequence 1:NP_650610.1 Gene:CG5292 / 42079 FlyBaseID:FBgn0038491 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001379202.1 Gene:C08E8.4 / 182409 WormBaseID:WBGene00007440 Length:209 Species:Caenorhabditis elegans


Alignment Length:86 Identity:19/86 - (22%)
Similarity:34/86 - (39%) Gaps:15/86 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FMEEALVE---------ARRARDAGEVPVGCVFVHG--DKVVARGGNEVNVHR----NATRHAEF 53
            |.||.:::         ..:|...|:|....|.:..  ..|:...|.::|::|    |.|:.:..
 Worm    46 FKEEEMLKFNCSEQYFMYHKALLVGDVDSAKVIITAKHPMVMKMTGRQLNMNRHDIDNWTQKSRD 110

  Fly    54 ICIDAILASCRERRLPARQLF 74
            |...|.||...:.....:.||
 Worm   111 IMYLACLAKFSQNVELRKMLF 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5292NP_650610.1 TadA 1..146 CDD:440355 19/86 (22%)
C08E8.4NP_001379202.1 NADAR 16..182 CDD:462576 19/86 (22%)

Return to query results.
Submit another query.