DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5285 and smug1

DIOPT Version :9

Sequence 1:NP_650609.1 Gene:CG5285 / 42078 FlyBaseID:FBgn0038490 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001373273.1 Gene:smug1 / 570901 ZFINID:ZDB-GENE-030131-9473 Length:277 Species:Danio rerio


Alignment Length:259 Identity:90/259 - (34%)
Similarity:134/259 - (51%) Gaps:2/259 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LEIGEPTKTSARQGSTSEFFDKPLWL-KFYETEVKLNEALEKLNPPESTPFIYNPIVYASQLHCD 76
            ||.|:.:|......:....|:..... :|.:.|::||..|:.|:......:.|||:.||.:.|..
Zfish    10 LESGDASKREVPDLAVERLFNSSTAASRFLQAELELNARLQMLSFGNPVRYTYNPLEYAWETHQC 74

  Fly    77 YLRRYMDGPKKLVFVGMNPGPNGMAQTGIPFGNVRTVKLLMQLAGSVDQPPVVHPKRPVAGLDCR 141
            |:..|....:.::|:||||||.||||||:|||.|:.|:..:::.|.|.:|...||||.:.||||.
Zfish    75 YVENYCQEGQSVLFLGMNPGPFGMAQTGVPFGEVKAVRNWLKITGRVGRPADEHPKRRITGLDCT 139

  Fly   142 IEEPSGVRLWELFLRLAGSMQTFSQQCFVHNFCPLAFFGADGRNITPSEIRGAYKNQLGDLCLHT 206
            ..|.||.|.|..|..|.|....|.:.|||||.|||.|....|:|:||.|:..|.::.|...|...
Zfish   140 QSEVSGARFWGFFQELCGEPNNFFRHCFVHNLCPLIFMSESGKNLTPPELPAAERDALLSCCDSA 204

  Fly   207 LEEQLKLLQPDVIVAVGEYVHSALKRSGYAKSNCVSVLRLPHPSPRS-TNNTNWPEKAQAFLEE 269
            |...:..|...:::.||:......:|:.......|.|..:.|||||: ..|..|...|:..|::
Zfish   205 LCRVVTALGISMVIGVGKLSEQRARRALSEAGISVRVEGIMHPSPRNPLANKGWASVARDKLDQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5285NP_650609.1 UDG_like 39..270 CDD:294330 85/232 (37%)
smug1NP_001373273.1 UDG-F3_SMUG1-like 36..267 CDD:381689 84/230 (37%)
motif A 90..94 CDD:381689 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575203
Domainoid 1 1.000 138 1.000 Domainoid score I4835
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8629
Inparanoid 1 1.050 171 1.000 Inparanoid score I4099
OMA 1 1.010 - - QHG63070
OrthoDB 1 1.010 - - D408493at33208
OrthoFinder 1 1.000 - - FOG0008217
OrthoInspector 1 1.000 - - oto40799
orthoMCL 1 0.900 - - OOG6_108141
Panther 1 1.100 - - LDO PTHR13235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.