DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5285 and smug1

DIOPT Version :9

Sequence 1:NP_650609.1 Gene:CG5285 / 42078 FlyBaseID:FBgn0038490 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001090786.1 Gene:smug1 / 100037877 XenbaseID:XB-GENE-953121 Length:274 Species:Xenopus tropicalis


Alignment Length:262 Identity:91/262 - (34%)
Similarity:145/262 - (55%) Gaps:10/262 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GEPTKTSARQGSTSEFFDKPLWLKFYETEVKLNEALEKLNPPESTPFIYNPIVYASQLHCDYLRR 80
            |.|:.|::.:...:.|.         :.|::||..|..|...:...::|||::||...|..|::.
 Frog    20 GVPSITASAECPANNFL---------KVELELNLKLSNLVFQDPIQYVYNPLLYAWAPHEKYVQT 75

  Fly    81 YMDGPKKLVFVGMNPGPNGMAQTGIPFGNVRTVKLLMQLAGSVDQPPVVHPKRPVAGLDCRIEEP 145
            |....|:::|:||||||.||||||:|||.|..|:..:|:.|.|.:|.|.||||.:.|.:|...|.
 Frog    76 YCQSRKEVLFLGMNPGPFGMAQTGVPFGEVNHVRNWLQIEGPVSKPEVEHPKRRIRGFECPQSEV 140

  Fly   146 SGVRLWELFLRLAGSMQTFSQQCFVHNFCPLAFFGADGRNITPSEIRGAYKNQLGDLCLHTLEEQ 210
            ||.|.|..|..|.|..:||.|.|||||.|||.|....|:|:||:::..|.:..|.::|...|.:.
 Frog   141 SGARFWSFFKSLCGQPETFFQHCFVHNHCPLIFMNHSGKNLTPTDLPKAQRETLLEICDEALCQA 205

  Fly   211 LKLLQPDVIVAVGEYVHSALKRSGYAKSNCVSVLRLPHPSPRSTN-NTNWPEKAQAFLEEHNLIR 274
            :::|...:::.||.:.....:::..|:...|:|..:.|||||:.. |..|.....|.|:|..::.
 Frog   206 VRVLGVKLVIGVGRFSEQRARKALTAEGIDVTVKGIMHPSPRNPQANKGWEGVVSAQLQELGVLS 270

  Fly   275 FM 276
            .:
 Frog   271 LL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5285NP_650609.1 UDG_like 39..270 CDD:294330 86/231 (37%)
smug1NP_001090786.1 UDG_F3_SMUG 34..266 CDD:198427 87/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4411
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H8629
Inparanoid 1 1.050 179 1.000 Inparanoid score I3905
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D408493at33208
OrthoFinder 1 1.000 - - FOG0008217
OrthoInspector 1 1.000 - - oto102833
Panther 1 1.100 - - LDO PTHR13235
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5396
SonicParanoid 1 1.000 - - X6187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.