DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Birc3

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_076477.3 Gene:Birc3 / 78971 RGDID:621282 Length:638 Species:Rattus norvegicus


Alignment Length:87 Identity:33/87 - (37%)
Similarity:47/87 - (54%) Gaps:14/87 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            |:.|:.:|::||.   :..|.:::|:||||:||   ..|...||.||..|..|:.:|||..||.:
  Rat   205 EKARLLTYQTWPL---SFLSPAELAKAGFYYTG---PGDRVACFACGGKLSNWDRKDDPLSEHRR 263

  Fly    93 HAPQCEFAKLSCPERNLTVSQF 114
            |.|.|.|.|        .|.||
  Rat   264 HFPSCPFLK--------DVGQF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 28/69 (41%)
Birc3NP_076477.3 BIR 68..133 CDD:395528
BIR 206..272 CDD:237989 28/71 (39%)
BIR 290..358 CDD:197595
UBA_BIRC2_3 412..461 CDD:270577
DD 476..564 CDD:417479
RING-HC_BIRC2_3_7 585..638 CDD:319627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.