DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and birc5l

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001037948.1 Gene:birc5l / 733575 XenbaseID:XB-GENE-966741 Length:139 Species:Xenopus tropicalis


Alignment Length:120 Identity:43/120 - (35%)
Similarity:60/120 - (50%) Gaps:22/120 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAP 95
            |:.::.:|||.|..:|:..:||||||....:....|...||.|.|.|:||:|||||..||.||:|
 Frog    13 RLSTFANWPFTEDCACTPERMAEAGFVHCPSDNSPDVVKCFFCLKELEGWQPEDDPMDEHKKHSP 77

  Fly    96 QCEFAKLSCPERNLTVSQFLEI----------------------LGTVVKGSIEK 128
            .|.|..|......||:|:||::                      ...||:|.:||
 Frog    78 SCLFIALKKKAEELTLSEFLKLDLERTKIKMQKQMNQHIENFQAKANVVRGHLEK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 32/69 (46%)
birc5lNP_001037948.1 BIR 13..82 CDD:306999 31/68 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8369
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I4943
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 1 1.000 - - FOG0003448
OrthoInspector 1 1.000 - - otm49094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 1 1.000 - - X3341
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.