powered by:
Protein Alignment Det and UBE2Z
DIOPT Version :9
Sequence 1: | NP_650608.1 |
Gene: | Det / 42077 |
FlyBaseID: | FBgn0264291 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_075567.2 |
Gene: | UBE2Z / 65264 |
HGNCID: | 25847 |
Length: | 354 |
Species: | Homo sapiens |
Alignment Length: | 51 |
Identity: | 15/51 - (29%) |
Similarity: | 21/51 - (41%) |
Gaps: | 13/51 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 GWEPEDDP-----WKEHVKH----APQCEF--AKLSCPE--RNLTVSQFLE 116
|:|.|..| :.|.::| ...|:. .|..||| |.:....|||
Human 227 GFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLE 277
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1404665at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.