DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Birc5

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_038942711.1 Gene:Birc5 / 64041 RGDID:70499 Length:146 Species:Rattus norvegicus


Alignment Length:60 Identity:31/60 - (51%)
Similarity:42/60 - (70%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LEQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDP 86
            |:.||:.::|:|||.|..||:..:||||||....|:.|.|.|.||.|.|.|:||||:|:|
  Rat    14 LKDHRISTFKNWPFLEDCSCTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNP 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 29/56 (52%)
Birc5XP_038942711.1 BIR 18..76 CDD:395528 29/56 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7951
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4877
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 1 1.000 - - FOG0003448
OrthoInspector 1 1.000 - - oto98096
orthoMCL 1 0.900 - - OOG6_104442
Panther 1 1.100 - - O PTHR46771
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3341
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.