DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Xiap

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_006257568.1 Gene:Xiap / 63879 RGDID:620692 Length:536 Species:Rattus norvegicus


Alignment Length:84 Identity:32/84 - (38%)
Similarity:46/84 - (54%) Gaps:9/84 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            |:.|::::::|  |:.|..|..::|.||.|:||.   :|...||.||..|..|||.|..|.||.:
  Rat   203 EEARLKTFQNW--PDYAHLSPRELASAGLYYTGI---DDQVQCFCCGGKLKNWEPCDRAWSEHRR 262

  Fly    93 HAPQCEFAKLSCPERNLTV 111
            |.|.|.|..    .||:.|
  Rat   263 HFPNCFFVL----GRNVNV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 28/69 (41%)
XiapXP_006257568.1 BIR 68..135 CDD:237989
BIR 202..272 CDD:197595 29/77 (38%)
BIR 304..370 CDD:197595
UBA_BIRC4_8 409..458 CDD:270578
zf-C3HC4_3 485..528 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.