DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Birc2

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_068520.2 Gene:Birc2 / 60371 RGDID:620690 Length:589 Species:Rattus norvegicus


Alignment Length:85 Identity:34/85 - (40%)
Similarity:46/85 - (54%) Gaps:6/85 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            |:.|..||..||.   :..|.:::|:||||:||   ..|...||.||..|..|||.|||..||.:
  Rat   156 EEARFLSYSMWPL---SFLSPAELAKAGFYYTG---PGDRVACFACGGKLSNWEPNDDPLSEHRR 214

  Fly    93 HAPQCEFAKLSCPERNLTVS 112
            |.|.|.|.:.:...:..:||
  Rat   215 HFPHCPFLENTSETQRFSVS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 31/69 (45%)
Birc2NP_068520.2 BIR 24..93 CDD:197595
BIR 155..224 CDD:197595 32/73 (44%)
BIR 240..308 CDD:197595
UBA_BIRC2_3 362..408 CDD:270577
CARD_BIRC2_BIRC3 425..514 CDD:260038
zf-C3HC4_3 538..583 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.