DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and xiap

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_031746347.1 Gene:xiap / 594971 XenbaseID:XB-GENE-948846 Length:519 Species:Xenopus tropicalis


Alignment Length:105 Identity:34/105 - (32%)
Similarity:49/105 - (46%) Gaps:31/105 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQHRVESYKSWP--FPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEH 90
            |:.|::::::||  .|.|.    .::|.||.::||.   ||...||.||..|..|||.|..|.||
 Frog   196 EEARLQTFQNWPAYSPLTP----KELANAGLFYTGI---NDQVKCFCCGGKLMNWEPSDKAWTEH 253

  Fly    91 VKHAPQCEF----------------------AKLSCPERN 108
            .||.|:|.|                      ::|:||..|
 Frog   254 KKHFPECYFVLGRDVGNVATEANTHGGRRRGSELACPAMN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 29/93 (31%)
xiapXP_031746347.1 BIR 67..131 CDD:395528
BIR 195..265 CDD:197595 30/75 (40%)
BIR 297..360 CDD:237989
UBA_like_SF 397..445 CDD:419673
RING-HC_BIRC4_8 458..519 CDD:319628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.