powered by:
Protein Alignment Det and ube2z
DIOPT Version :9
Sequence 1: | NP_650608.1 |
Gene: | Det / 42077 |
FlyBaseID: | FBgn0264291 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002330.2 |
Gene: | ube2z / 436602 |
ZFINID: | ZDB-GENE-040718-15 |
Length: | 380 |
Species: | Danio rerio |
Alignment Length: | 51 |
Identity: | 16/51 - (31%) |
Similarity: | 24/51 - (47%) |
Gaps: | 13/51 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 GWEPEDDP-----WKEHVKHAPQ----CEF--AKLSCPERNLTVSQ--FLE 116
|:|.|..| :.|.::|... |:. .|:||||...:|.: |||
Zfish 251 GFEQERHPGDSKNYNECIRHETMRVAVCDMLEGKVSCPEALWSVMEKSFLE 301
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Det | NP_650608.1 |
BIR |
31..101 |
CDD:279047 |
7/32 (22%) |
ube2z | NP_001002330.2 |
UBCc |
127..245 |
CDD:238117 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1404665at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.