powered by:
Protein Alignment Det and Bruce
DIOPT Version :9
Sequence 1: | NP_650608.1 |
Gene: | Det / 42077 |
FlyBaseID: | FBgn0264291 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262460.1 |
Gene: | Bruce / 41260 |
FlyBaseID: | FBgn0266717 |
Length: | 4976 |
Species: | Drosophila melanogaster |
Alignment Length: | 74 |
Identity: | 28/74 - (37%) |
Similarity: | 39/74 - (52%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
|..|.::::.||..:.......:||:||||...:....|.|.||.|...|..||..|:||.||.:
Fly 248 EAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHER 312
Fly 93 HAPQCEFAK 101
|:|.|.|.|
Fly 313 HSPLCPFVK 321
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
55 |
1.000 |
Domainoid score |
I7415 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1101 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1404665at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.