DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Det and birc2

DIOPT Version :9

Sequence 1:	NP_650608.1	Gene:	Det / 42077	FlyBaseID:	FBgn0264291	Length:	153	Species:	Drosophila melanogaster
Sequence 2:	XP_005161213.1	Gene:	birc2 / 373107	ZFINID:	ZDB-GENE-030825-6	Length:	647	Species:	Danio rerio

Alignment Length:	105	Identity:	32/105 - (30%)
Similarity:	47/105 - (44%)	Gaps:	28/105 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            ||.|::::::|..   |:.:.:::|:||.|:.|   :.|...||.||..|..|||.|....||.:
Zfish   206 EQERLDTFQNWTL---ATVTPAELAKAGLYYLG---QGDRVACFSCGGQLGSWEPGDRAVSEHQR 264

  Fly    93 HAPQCEF----------------------AKLSCPERNLT 110
            |.|.|.|                      |...|.||.||
Zfish   265 HYPNCRFVRGDRADNIPLSGGGLSNVSNSAMQQCEERLLT 304

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Det	NP_650608.1	BIR	31..101	CDD:279047	24/91 (26%)
birc2	XP_005161213.1	BIR	51..117	CDD:237989
		BIR	206..274	CDD:197595	26/73 (36%)
		BIR	299..366	CDD:237989	4/6 (67%)
		UBA_BIRC2_3	420..466	CDD:270577
		CARD_BIRC2_BIRC3	482..573	CDD:260038
		zf-C3HC4_3	596..641	CDD:290631
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1101
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R141
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	3	2.840