powered by:
Protein Alignment Det and Diap2
DIOPT Version :9
Sequence 1: | NP_650608.1 |
Gene: | Det / 42077 |
FlyBaseID: | FBgn0264291 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_477127.1 |
Gene: | Diap2 / 36748 |
FlyBaseID: | FBgn0015247 |
Length: | 498 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 25/73 - (34%) |
Similarity: | 39/73 - (53%) |
Gaps: | 5/73 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 RVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAP 95
|:.::..||....... |.:|:||.|: ::..|...||.|...|..|:.||:||.||.|.:|
Fly 215 RLRTFTDWPISNIQPA--SALAQAGLYY---QKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSP 274
Fly 96 QCEFAKLS 103
:|:|..|:
Fly 275 KCQFVLLA 282
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1101 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R141 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.