DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Diap2

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster


Alignment Length:73 Identity:25/73 - (34%)
Similarity:39/73 - (53%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAP 95
            |:.::..||.......  |.:|:||.|:   ::..|...||.|...|..|:.||:||.||.|.:|
  Fly   215 RLRTFTDWPISNIQPA--SALAQAGLYY---QKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSP 274

  Fly    96 QCEFAKLS 103
            :|:|..|:
  Fly   275 KCQFVLLA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 24/69 (35%)
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595
BIR 213..281 CDD:237989 24/70 (34%)
UBA_IAPs 320..363 CDD:270506
zf-C3HC4_3 447..492 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.