DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and XIAP

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001158.2 Gene:XIAP / 331 HGNCID:592 Length:497 Species:Homo sapiens


Alignment Length:84 Identity:32/84 - (38%)
Similarity:45/84 - (53%) Gaps:9/84 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            |:.|::|:::|  |:.|..:..::|.||.|:||.   .|...||.||..|..|||.|..|.||.:
Human   163 EEARLKSFQNW--PDYAHLTPRELASAGLYYTGI---GDQVQCFCCGGKLKNWEPCDRAWSEHRR 222

  Fly    93 HAPQCEFAKLSCPERNLTV 111
            |.|.|.|..    .|||.:
Human   223 HFPNCFFVL----GRNLNI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 28/69 (41%)
XIAPNP_001158.2 BIR 1 26..93
BIR 28..95 CDD:237989
Interaction with caspase-7 141..149
BIR 162..232 CDD:197595 29/77 (38%)
BIR 2 163..230 28/71 (39%)
BIR 265..331 CDD:197595
BIR 3 265..330
UBA_BIRC4_8 370..419 CDD:270578
RING-HC_BIRC4_8 436..497 CDD:319628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.