DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and BIRC3

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001156.1 Gene:BIRC3 / 330 HGNCID:591 Length:604 Species:Homo sapiens


Alignment Length:110 Identity:34/110 - (30%)
Similarity:55/110 - (50%) Gaps:15/110 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            |..|:.::::||.   ...|.:.:|:||||:.|   ..|...||.||..|..|||:|:...||::
Human   169 ENARLLTFQTWPL---TFLSPTDLAKAGFYYIG---PGDRVACFACGGKLSNWEPKDNAMSEHLR 227

  Fly    93 HAPQCEFAKLSCPERNLTVSQFLEILGTVVKGSIEKTCKAFKSSF 137
            |.|:|.|.:....:    .|::     ||...|::.....||:.|
Human   228 HFPKCPFIENQLQD----TSRY-----TVSNLSMQTHAARFKTFF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 26/69 (38%)
BIRC3NP_001156.1 BIR 28..98 CDD:197595
BIR 1 29..96
BIR 168..237 CDD:197595 27/73 (37%)
BIR 2 169..235 26/71 (37%)
BIR 254..322 CDD:197595 3/10 (30%)
BIR 3 255..322 3/9 (33%)
UBA_like_SF 377..>411 CDD:304366
CARD_BIRC2_BIRC3 441..530 CDD:260038
zf-C3HC4_3 553..598 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.