DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Birc6

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001164067.1 Gene:Birc6 / 313876 RGDID:1307247 Length:4865 Species:Rattus norvegicus


Alignment Length:127 Identity:44/127 - (34%)
Similarity:54/127 - (42%) Gaps:28/127 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPVVNE------------VAAS---------------LG-GEKLEVFRKLNLLEQHRVESYKSWP 39
            |.:|||            ||:|               || |....|.|.|...|.:|.|::.|||
  Rat   236 SAIVNELKKINQNVAALPVASSVMDRLSYLLPSARPELGVGPGRSVDRALMYSEANRRETFTSWP 300

  Fly    40 FPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAPQCEFAK 101
            ...........||:||||.......:|.|.||.|...|..|||.|:||.||.:|:|.|.|.|
  Rat   301 HVGYRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPFVK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 29/69 (42%)
Birc6NP_001164067.1 BIR 290..363 CDD:237989 30/73 (41%)
DUF3643 3472..3624 CDD:289152
UBCc 4605..4743 CDD:238117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.