DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Ube2z

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001032732.2 Gene:Ube2z / 303478 RGDID:1308347 Length:356 Species:Rattus norvegicus


Alignment Length:51 Identity:15/51 - (29%)
Similarity:21/51 - (41%) Gaps:13/51 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GWEPEDDP-----WKEHVKH----APQCEF--AKLSCPE--RNLTVSQFLE 116
            |:|.|..|     :.|.::|    ...|:.  .|..|||  |.:....|||
  Rat   229 GFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 7/32 (22%)
Ube2zNP_001032732.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
UBCc 105..223 CDD:238117
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.