DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and birc5b

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_660196.1 Gene:birc5b / 246726 ZFINID:ZDB-GENE-030826-2 Length:128 Species:Danio rerio


Alignment Length:89 Identity:34/89 - (38%)
Similarity:52/89 - (58%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKH 93
            :.|::::..|||.|...|:...||:|||....::.|.|.|.||.|.:.|:||||:|:||.||.|.
Zfish     5 EKRLQTFSEWPFREDCQCTPELMAKAGFVHCPSENEPDVACCFYCLRELEGWEPDDNPWSEHAKR 69

  Fly    94 APQCEFAKLSCPERNLTVSQFLEI 117
            :|.|.|..:|.....||..::..:
Zfish    70 SPNCAFLHMSKTFDELTAIEYFHL 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 31/69 (45%)
birc5bNP_660196.1 BIR 7..77 CDD:279047 31/69 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8359
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I5039
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 1 1.000 - - FOG0003448
OrthoInspector 1 1.000 - - otm26366
orthoMCL 1 0.900 - - OOG6_104442
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 1 1.000 - - X3341
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.