DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Det and Naip6

DIOPT Version :9

Sequence 1:	NP_650608.1	Gene:	Det / 42077	FlyBaseID:	FBgn0264291	Length:	153	Species:	Drosophila melanogaster
Sequence 2:	XP_006231924.1	Gene:	Naip6 / 191568	RGDID:	621281	Length:	1403	Species:	Rattus norvegicus

Alignment Length:	114	Identity:	43/114 - (37%)
Similarity:	64/114 - (56%)	Gaps:	14/114 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            |:.|:||::.||| .....|...::.|||.:||   :.||..||.||..|..||..|||||||.|
  Rat   159 EEARLESFEDWPF-YAHGTSPRVLSAAGFVFTG---KRDTVQCFSCGGCLGNWEEGDDPWKEHAK 219

  Fly    93 HAPQCEF--AKLSCPERNLTVSQFLEILGTVVKGSIEKTCKAFKSSFVR 139
            ..|:|||  :|.|..|    ::::::    ..:|.:..|.:.|.:|:||
  Rat   220 WFPKCEFLQSKKSAEE----IAKYIQ----TYEGFLHVTGEHFVNSWVR 260

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Det	NP_650608.1	BIR	31..101	CDD:279047	33/71 (46%)
Naip6	XP_006231924.1	BIR	61..127	CDD:237989
		BIR	162..228	CDD:395528	33/69 (48%)
		BIR	281..346	CDD:395528
		NACHT	464..618	CDD:399032
		NLRC4_HD	766..872	CDD:407744
		leucine-rich repeat	1055..1078	CDD:275380
		leucine-rich repeat	1079..1100	CDD:275380
		LRR_RI	1080..1329	CDD:423007
		leucine-rich repeat	1104..1130	CDD:275380
		leucine-rich repeat	1157..1182	CDD:275381
		leucine-rich repeat	1183..1207	CDD:275381
		leucine-rich repeat	1208..1236	CDD:275381
		leucine-rich repeat	1237..1261	CDD:275381
		leucine-rich repeat	1262..1293	CDD:275381
		leucine-rich repeat	1294..1322	CDD:275381
		leucine-rich repeat	1323..1355	CDD:275381
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910