DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and bir-2

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_506362.1 Gene:bir-2 / 179841 WormBaseID:WBGene00000250 Length:308 Species:Caenorhabditis elegans


Alignment Length:163 Identity:48/163 - (29%)
Similarity:83/163 - (50%) Gaps:24/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ESPVVNEVAASLGGEKLEVFRKLN--LLEQHRVESYKSWPFPE--TASCSISKMAEAGFYWTGTK 62
            |:|:....|.    .||..||..:  |...||:.:::::.|.:  ...|:..|:|:||::....|
 Worm   143 ENPITRADAT----RKLISFRSSSKLLTFDHRLATFQNFIFDKKRNVKCTSKKLAKAGWFSIANK 203

  Fly    63 RENDTATCFVCGKTLDGWEPEDDPWKEHVKHAPQCEFAKL-SCPERNLTVSQFLEILG---TVVK 123
            ::..:|.|..|...|| ::..||||:||.|.:..|:|.|| ...|:..|.::.| :||   |:::
 Worm   204 KDKTSAKCPFCLVELD-FDESDDPWEEHQKFSASCDFIKLGKLDEKKWTENEAL-MLGARITIMQ 266

  Fly   124 GSIEKTCKAFKSSFV---RENEKRLDEFTRNQK 153
                   |..|.|::   .|.|.|:||..:.:|
 Worm   267 -------KYEKGSWLIDELEKENRIDEIIKIRK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 22/71 (31%)
bir-2NP_506362.1 BIR 23..99 CDD:197595
BIR 166..242 CDD:197595 23/76 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I7415
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 1 1.000 - - FOG0003448
OrthoInspector 1 1.000 - - otm14297
orthoMCL 1 0.900 - - OOG6_104442
Panther 1 1.100 - - O PTHR46771
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.