DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Naip5

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_035000.2 Gene:Naip5 / 17951 MGIID:1298220 Length:1403 Species:Mus musculus


Alignment Length:139 Identity:48/139 - (34%)
Similarity:69/139 - (49%) Gaps:30/139 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            |:.|:||::.||| .....|...::.|||.:||   :.||..||.||.:|..||..|||||||.|
Mouse   159 EEARLESFEDWPF-YAHGTSPRVLSAAGFVFTG---KRDTVQCFSCGGSLGNWEEGDDPWKEHAK 219

  Fly    93 HAPQCEF--AKLSCPERNLTVSQFLEILGTVVKGSIEKTCKAFKSSFVR---------------- 139
            ..|:|||  :|.|..|    ::|:::    ..:|.:..|.:.|..|:||                
Mouse   220 WFPKCEFLQSKKSSEE----IAQYIQ----SYEGFVHVTGEHFVKSWVRRELPMVSAYCNDSVFA 276

  Fly   140 ENEKRLDEF 148
            ..|.|:|.|
Mouse   277 NEELRMDMF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 33/71 (46%)
Naip5NP_035000.2 BIR 1 60..127
BIR 61..129 CDD:237989
BIR 2 159..227 33/71 (46%)
BIR 162..228 CDD:366227 33/69 (48%)
BIR 3 278..345 4/8 (50%)
BIR 279..346 CDD:237989 4/7 (57%)
NACHT 464..618 CDD:368582
NOD2_WH 688..743 CDD:375327
NLRC4_HD 767..873 CDD:375406
leucine-rich repeat 1055..1078 CDD:275380
AMN1 1072..1271 CDD:187754
leucine-rich repeat 1079..1100 CDD:275380
leucine-rich repeat 1104..1130 CDD:275380
leucine-rich repeat 1132..1156 CDD:275381
leucine-rich repeat 1157..1182 CDD:275381
leucine-rich repeat 1183..1207 CDD:275381
leucine-rich repeat 1208..1236 CDD:275381
leucine-rich repeat 1265..1293 CDD:275381
leucine-rich repeat 1294..1322 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.