DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Det and Naip1

DIOPT Version :9

Sequence 1:	NP_650608.1	Gene:	Det / 42077	FlyBaseID:	FBgn0264291	Length:	153	Species:	Drosophila melanogaster
Sequence 2:	NP_032696.2	Gene:	Naip1 / 17940	MGIID:	1298223	Length:	1403	Species:	Mus musculus

Alignment Length:	139	Identity:	48/139 - (34%)
Similarity:	70/139 - (50%)	Gaps:	30/139 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            |:.|:||::.||| .....|...::.|||.:||   :.||..||.||.:|..||..|||||||.|
Mouse   159 EEARLESFEDWPF-YAHGTSPRVLSAAGFVFTG---KRDTVQCFSCGGSLGNWEEGDDPWKEHAK 219

  Fly    93 HAPQCEF--AKLSCPERNLTVSQFLEILGTVVKGSIEKTCKAFKSSFVR---------------- 139
            ..|:|||  :|.|..|    ::|:::    ..:|.:..|.:.|.:|:||
Mouse   220 WFPKCEFLQSKKSSEE----IAQYIQ----GYEGFVHVTGEHFVNSWVRRELPMVSAYCNDSVFA 276

  Fly   140 ENEKRLDEF 148
            ..|.|:|.|
Mouse   277 NEELRMDTF 285

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Det	NP_650608.1	BIR	31..101	CDD:279047	33/71 (46%)
Naip1	NP_032696.2	BIR	61..129	CDD:237989
		BIR 1	63..128
		BIR	159..229	CDD:197595	34/73 (47%)
		BIR 2	162..228		33/69 (48%)
		BIR	279..346	CDD:237989	4/7 (57%)
		BIR 3	281..346		3/5 (60%)
		NACHT	464..617	CDD:283404
		AAA	465..600	CDD:214640
		AMN1	1072..>1191	CDD:187754
		leucine-rich repeat	1132..1156	CDD:275381
		leucine-rich repeat	1157..1182	CDD:275381
		leucine-rich repeat	1183..1236	CDD:275381
		leucine-rich repeat	1237..1261	CDD:275381
		leucine-rich repeat	1262..1293	CDD:275381
		leucine-rich repeat	1294..1322	CDD:275381
		leucine-rich repeat	1323..1355	CDD:275381
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910