DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Birc5

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_033819.1 Gene:Birc5 / 11799 MGIID:1203517 Length:140 Species:Mus musculus


Alignment Length:127 Identity:49/127 - (38%)
Similarity:69/127 - (54%) Gaps:11/127 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LEQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHV 91
            |:.:|:.::|:|||.|..:|:..:||||||....|:.|.|.|.||.|.|.|:||||:|:|.:||.
Mouse    14 LKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHR 78

  Fly    92 KHAPQCEFAKLSCPERNLTVSQFLEILGTVVKGSIEKTCKAFKSSFVRENEKRLDEFTRNQK 153
            ||:|.|.|..:......||||:||::.....|..|.|           |...:..||....|
Mouse    79 KHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAK-----------ETNNKQKEFEETAK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 35/69 (51%)
Birc5NP_033819.1 BIR 18..88 CDD:279047 35/69 (51%)
BIR 18..88 35/69 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..140 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8199
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4991
Isobase 1 0.950 - 0.878984 Normalized mean entropy S5349
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1404665at2759
OrthoFinder 1 1.000 - - FOG0003448
OrthoInspector 1 1.000 - - oto94584
orthoMCL 1 0.900 - - OOG6_104442
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 1 1.000 - - X3341
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.