DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Xiap

DIOPT Version :10

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_011249278.1 Gene:Xiap / 11798 MGIID:107572 Length:548 Species:Mus musculus


Alignment Length:84 Identity:32/84 - (38%)
Similarity:46/84 - (54%) Gaps:9/84 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            |:.|::|:::|  |:.|..:..::|.||.|:||.   :|...||.||..|..|||.|..|.||.:
Mouse   215 EEARLKSFQNW--PDYAHLTPRELASAGLYYTGA---DDQVQCFCCGGKLKNWEPCDRAWSEHRR 274

  Fly    93 HAPQCEFAKLSCPERNLTV 111
            |.|.|.|..    .||:.|
Mouse   275 HFPNCFFVL----GRNVNV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:459891 28/69 (41%)
XiapXP_011249278.1 BIR 80..147 CDD:237989
BIR 214..284 CDD:197595 29/77 (38%)
BIR 316..382 CDD:197595
UBA_BIRC4_8 421..470 CDD:270578
RING-HC_BIRC4_8 485..548 CDD:438374
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.