DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Birc2

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001278432.1 Gene:Birc2 / 11797 MGIID:1197009 Length:612 Species:Mus musculus


Alignment Length:85 Identity:30/85 - (35%)
Similarity:44/85 - (51%) Gaps:6/85 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            |:.|..:|..||.   :..|.:::|.||||:.|   ..|...||.||..|..|||:||...||.:
Mouse   177 EEARFLTYSMWPL---SFLSPAELARAGFYYIG---PGDRVACFACGGKLSNWEPKDDAMSEHRR 235

  Fly    93 HAPQCEFAKLSCPERNLTVS 112
            |.|.|.|.:.:...:..::|
Mouse   236 HFPHCPFLENTSETQRFSIS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 28/69 (41%)
Birc2NP_001278432.1 BIR 45..114 CDD:197595
BIR 1 46..113
BIR 176..245 CDD:197595 29/73 (40%)
BIR 2 177..243 28/71 (39%)
BIR 3 262..329
BIR 263..329 CDD:237989
UBA_BIRC2_3 385..431 CDD:270577
CARD_BIRC2_BIRC3 447..538 CDD:260038
RING-HC_BIRC2_3_7 559..612 CDD:319627
RING-HC finger (C3HC4-type) 565..599 CDD:319627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.