DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and Birc3

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_006509891.1 Gene:Birc3 / 11796 MGIID:1197007 Length:681 Species:Mus musculus


Alignment Length:88 Identity:32/88 - (36%)
Similarity:47/88 - (53%) Gaps:8/88 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GEKLEVFRKLNL-LEQH--RVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKT 76
            |:....:...|| ::.|  |:.::.:|  |.:|.....::|.||||:||   .:|...||.|...
Mouse   318 GQSASRYTVSNLSMQTHAARIRTFSNW--PSSALVHSQELASAGFYYTG---HSDDVKCFCCDGG 377

  Fly    77 LDGWEPEDDPWKEHVKHAPQCEF 99
            |..||..||||.||.|..|:||:
Mouse   378 LRCWESGDDPWVEHAKWFPRCEY 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 28/69 (41%)
Birc3XP_006509891.1 BIR 107..176 CDD:197595
BIR 247..315 CDD:197595
BIR 333..403 CDD:197595 29/73 (40%)
UBA_BIRC2_3 455..504 CDD:270577
CARD_BIRC2_BIRC3 519..607 CDD:260038
RING-HC_BIRC2_3_7 628..681 CDD:319627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.