DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Det and birc7

DIOPT Version :9

Sequence 1:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001106593.2 Gene:birc7 / 100127811 XenbaseID:XB-GENE-5914029 Length:385 Species:Xenopus tropicalis


Alignment Length:102 Identity:32/102 - (31%)
Similarity:47/102 - (46%) Gaps:19/102 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVK 92
            |..|:.|:.:|  |..|:....::|.|||::||   ..|...||.|...|..||..||||.||.|
 Frog   132 EGDRLGSFSTW--PRYANGDPQQLAGAGFFYTG---HRDHVKCFHCDGGLRNWEQGDDPWTEHAK 191

  Fly    93 HAPQCEFAKLSCPERNLTVSQFLEILGTVVKGSIEKT 129
            ..|.|:|              .|::.|.....|::::
 Frog   192 WFPMCDF--------------LLQVKGEAFIRSVQES 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DetNP_650608.1 BIR 31..101 CDD:279047 28/69 (41%)
birc7NP_001106593.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.