| Sequence 1: | NP_650607.1 | Gene: | m-cup / 42076 | FlyBaseID: | FBgn0038488 | Length: | 702 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_192259.1 | Gene: | AT4G03500 / 827731 | AraportID: | AT4G03500 | Length: | 652 | Species: | Arabidopsis thaliana |
| Alignment Length: | 253 | Identity: | 56/253 - (22%) |
|---|---|---|---|
| Similarity: | 92/253 - (36%) | Gaps: | 61/253 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 42 SMANERKQSSPKVELTKLSHDLIEECKRSQEDSLLSR-----HLRHE----------------LE 85
Fly 86 KLPRDSRRELVRKQRNGCAPLFIACKRGAVDIAEYLITICEANIEQRGHFEVPEDNSFHYVSPLW 150
Fly 151 AAVVSGKLSMVKYLVRIGCD------INATSDSGSTPVRSACYMTHVDIVK-FLVENGADIKRPN 208
Fly 209 INGGTCLINSVQSVQLCLYLVRKGADINARDIQDKTALHYAIQEHRLDTTKLLIEQGA 266 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| m-cup | NP_650607.1 | ANK repeat | 101..175 | CDD:293786 | 21/79 (27%) |
| Ank_2 | <101..174 | CDD:289560 | 21/78 (27%) | ||
| ANK | 147..262 | CDD:238125 | 25/121 (21%) | ||
| Ank_2 | 149..239 | CDD:289560 | 22/96 (23%) | ||
| ANK repeat | 177..208 | CDD:293786 | 9/31 (29%) | ||
| ANK repeat | 210..239 | CDD:293786 | 4/28 (14%) | ||
| ANK repeat | 241..271 | CDD:293786 | 6/26 (23%) | ||
| Ank_4 | 244..294 | CDD:290365 | 6/23 (26%) | ||
| ANK | 591..>657 | CDD:238125 | |||
| Ank_2 | 591..>641 | CDD:289560 | |||
| ANK repeat | 611..641 | CDD:293786 | |||
| AT4G03500 | NP_192259.1 | Ank_2 | 73..166 | CDD:289560 | |
| ANK | 98..231 | CDD:238125 | |||
| ANK repeat | 101..132 | CDD:293786 | |||
| ANK repeat | 135..178 | CDD:293786 | |||
| Ank_2 | 185..278 | CDD:289560 | 10/44 (23%) | ||
| ANK | 212..368 | CDD:238125 | 32/143 (22%) | ||
| ANK repeat | 214..244 | CDD:293786 | 2/10 (20%) | ||
| ANK repeat | 246..278 | CDD:293786 | 6/31 (19%) | ||
| ANK | 311..437 | CDD:238125 | 36/152 (24%) | ||
| ANK repeat | 313..345 | CDD:293786 | 11/34 (32%) | ||
| Ank_2 | 319..418 | CDD:289560 | 28/107 (26%) | ||
| ANK repeat | 347..384 | CDD:293786 | 10/42 (24%) | ||
| ANK repeat | 386..418 | CDD:293786 | 9/31 (29%) | ||
| PGG | 473..581 | CDD:290670 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 77 | 1.000 | Inparanoid score | I2399 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X100 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.050 | |||||