DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m-cup and ACD6

DIOPT Version :9

Sequence 1:NP_650607.1 Gene:m-cup / 42076 FlyBaseID:FBgn0038488 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_567430.1 Gene:ACD6 / 827085 AraportID:AT4G14400 Length:670 Species:Arabidopsis thaliana


Alignment Length:510 Identity:97/510 - (19%)
Similarity:176/510 - (34%) Gaps:160/510 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LEKLPRDSRRELVR-KQRNGCAPLFIACKRGAVDIAEYLITICEANIEQRGHFEVPEDNSFHYVS 147
            |||| |.:...:.| |...|.:.|.||.|.|.:::.:.:|            ||.|         
plant    83 LEKL-RSNGTPMERVKSNTGDSILHIAAKWGHLELVKEII------------FECP--------- 125

  Fly   148 PLWAAVVSGKLSMVKYLVRIGCDINATSDSGSTPVRSACYMTHVDIVKFLVENGADIKRPNINGG 212
                                 |.:...:.|..||:..|.:..|..:|:.||        .::...
plant   126 ---------------------CLLFEQNSSRQTPLHVATHGGHTKVVEALV--------ASVTSA 161

  Fly   213 TCLINSVQSVQLCLYLVRKGADINARDIQDKTALHYAIQEHRLDTTKLLIEQGAD-PYARSRYGD 276
            ...:::.:|..|..:::        :|....|||:|||:...|:....|:....| |:..:..|.
plant   162 LASLSTEESEGLNPHVL--------KDEDGNTALYYAIEGRYLEMATCLVNADKDAPFLGNNKGI 218

  Fly   277 DALRTACLKGAHHIFDFLKKQLHYTP----------------------ARLAEAHELMG--STFL 317
            .:|..| :...:...|.:|..|..|.                      |.:|...:.:|  ...|
plant   219 SSLYEA-VDAGNKFEDLVKAILKTTDDNVDREVRKFNLDSKLQGNKHLAHVALKAKSIGVLDVIL 282

  Fly   318 DEH--------NESRVCILHWRMAHHI--------RAAYSPYI-EKKPQVPLRTA-----YENAV 360
            ||:        .:.|.|:.:.....:.        |:....|: ::....|:.:|     ||...
plant   283 DEYPSLMDEQDEDGRTCLSYGASIGYYKGLCNILNRSTKGVYVCDQDGSFPIHSAAKNEHYEIIK 347

  Fly   361 EFSTL------------EELDNIATDMDAMRTQSLLICERVLGLTHKDMLFRLTFRGASYADSLQ 413
            ||...            :.:.::|...:|..|..:|:.:       ||            ...|.
plant   348 EFIKRCPASKYLLNRLGQNILHVAAKNEASLTAYMLMHD-------KD------------TKHLG 393

  Fly   414 LQRCIDLWRFLLEVRVSNWSILHFE--TCFAAQALVRLMLDLHVQNSSHIRSDARARFVHQDKVL 476
            :.:.:| ....|.:.|.||.   |:  ||.|:    |....|.::|    :|..|||.:.:.:|.
plant   394 VGQDVD-GNTPLHLAVMNWD---FDSITCLAS----RNHEILKLRN----KSGLRARDIAESEVK 446

  Fly   477 P------RFEDVLGVFRTLSESAIVVKHLLLLR-PVFRRQQENYDRVMRCLAHLI 524
            |      |:...|.::...|.....||.|.:.. |:..::..:|...:..:|.|:
plant   447 PNYIFHERWTLALLLYAIHSSGFESVKSLTIQSVPLDPKKNRHYVNALLVVAALV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
m-cupNP_650607.1 ANK repeat 101..175 CDD:293786 11/73 (15%)
Ank_2 <101..174 CDD:289560 11/72 (15%)
ANK 147..262 CDD:238125 19/114 (17%)
Ank_2 149..239 CDD:289560 11/89 (12%)
ANK repeat 177..208 CDD:293786 8/30 (27%)
ANK repeat 210..239 CDD:293786 2/28 (7%)
ANK repeat 241..271 CDD:293786 10/30 (33%)
Ank_4 244..294 CDD:290365 14/50 (28%)
ANK 591..>657 CDD:238125
Ank_2 591..>641 CDD:289560
ANK repeat 611..641 CDD:293786
ACD6NP_567430.1 ANK 97..239 CDD:238125 38/200 (19%)
ANK repeat 101..132 CDD:293786 11/72 (15%)
Ank_2 105..208 CDD:289560 29/160 (18%)
ANK repeat 134..180 CDD:293786 10/61 (16%)
ANK repeat 182..209 CDD:293786 8/26 (31%)
Ank_2 267..352 CDD:289560 15/84 (18%)
ANK 290..419 CDD:238125 24/151 (16%)
ANK repeat 329..361 CDD:293786 6/31 (19%)
Ank_2 334..426 CDD:289560 22/118 (19%)
ANK repeat 363..397 CDD:293786 7/52 (13%)
PGG 506..594 CDD:290670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2399
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X100
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.