DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment m-cup and ankrd46b

DIOPT Version :9

Sequence 1:	NP_650607.1	Gene:	m-cup / 42076	FlyBaseID:	FBgn0038488	Length:	702	Species:	Drosophila melanogaster
Sequence 2:	NP_991159.1	Gene:	ankrd46b / 402888	ZFINID:	ZDB-GENE-050114-7	Length:	228	Species:	Danio rerio

Alignment Length:	114	Identity:	38/114 - (33%)
Similarity:	54/114 - (47%)	Gaps:	17/114 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   105 PLFIACKRGAVDIAEYLI-TICEANI-EQRGHFEVPEDNSFHYVSPLWAAVVSGKLSMVKYLVRI 167
            ||..||..|.:..|..|: |.|:.|| :.||.            :.|..|...|.:.:.::|.:.
Zfish    15 PLLQACIDGDLSFARRLLETGCDPNIRDHRGR------------TGLHLAAARGNVDICRFLHKF 67

  Fly   168 GCDINATSDSGSTPVRSACYMTHVDIVKFLVENGADIKRPNINGGTCLI 216
            |.|:.||...|:|.:. .|  .|||.::|||.||..|...|.||.|.|:
Zfish    68 GADLLATDYQGNTALH-LC--GHVDTIQFLVSNGLKIDICNHNGSTPLV 113

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
m-cup	NP_650607.1	ANK repeat	101..175	CDD:293786	20/71 (28%)
		Ank_2	<101..174	CDD:289560	19/70 (27%)
		ANK	147..262	CDD:238125	25/70 (36%)
		Ank_2	149..239	CDD:289560	25/68 (37%)
		ANK repeat	177..208	CDD:293786	12/30 (40%)
		ANK repeat	210..239	CDD:293786	4/7 (57%)
		ANK repeat	241..271	CDD:293786
		Ank_4	244..294	CDD:290365
		ANK	591..>657	CDD:238125
		Ank_2	591..>641	CDD:289560
		ANK repeat	611..641	CDD:293786
ankrd46b	NP_991159.1	ANK 1	11..40		9/24 (38%)
		ANK	15..128	CDD:238125	38/114 (33%)
		ANK repeat	15..42	CDD:293786	11/26 (42%)
		Ank_2	16..105	CDD:289560	32/103 (31%)
		ANK repeat	44..75	CDD:293786	9/42 (21%)
		ANK 2	44..73		8/40 (20%)
		ANK repeat	77..105	CDD:293786	12/30 (40%)
		ANK 3	77..103		12/28 (43%)
		ANK 4	107..138		4/7 (57%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0508
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900