DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m-cup and Ankrd46

DIOPT Version :9

Sequence 1:NP_650607.1 Gene:m-cup / 42076 FlyBaseID:FBgn0038488 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001013970.1 Gene:Ankrd46 / 299982 RGDID:1309382 Length:228 Species:Rattus norvegicus


Alignment Length:215 Identity:49/215 - (22%)
Similarity:87/215 - (40%) Gaps:19/215 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 PLWAAVVSGKLSMVKYLVRIGCDINATSDSGSTPVRSACYMTHVDIVKFLVENGADIKRPNINGG 212
            ||..|.:.|..:..|.|:..|.|.|.....|.|.:..|....:|||.:.|.:.|||....:..|.
  Rat    15 PLLQACIDGDFTYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADPLATDYQGN 79

  Fly   213 TC--LINSVQSVQLCLYLVRKGADINARDIQDKTALHYA----IQEHRLDTTKLLIEQGADPYAR 271
            |.  |...|.::|   :||..|..|:..:.|..|.|..|    :.:..:...:.|.||....:.|
  Rat    80 TALHLCGHVDTIQ---FLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNR 141

  Fly   272 SRYGD-DALRTACLKGAHHIFDFLKKQLHYTPARLAEAHELMGSTFLDEHNESRV-------CIL 328
            ..:.. :.::||..:.|......|...|......|: :.......|:::....||       .:|
  Rat   142 GTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLS-SFRTTWQEFVEDLGFWRVLLLILVIALL 205

  Fly   329 HWRMAHHIRAAYSPYIEKKP 348
            ...:|::: :...|:::.:|
  Rat   206 SLGIAYYV-SGVLPFVDNQP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
m-cupNP_650607.1 ANK repeat 101..175 CDD:293786 9/26 (35%)
Ank_2 <101..174 CDD:289560 9/25 (36%)
ANK 147..262 CDD:238125 32/119 (27%)
Ank_2 149..239 CDD:289560 27/91 (30%)
ANK repeat 177..208 CDD:293786 10/30 (33%)
ANK repeat 210..239 CDD:293786 9/30 (30%)
ANK repeat 241..271 CDD:293786 7/33 (21%)
Ank_4 244..294 CDD:290365 10/54 (19%)
ANK 591..>657 CDD:238125
Ank_2 591..>641 CDD:289560
ANK repeat 611..641 CDD:293786
Ankrd46NP_001013970.1 ANK 1 11..40 8/24 (33%)
ANK repeat 15..42 CDD:293786 9/26 (35%)
Ank_2 16..103 CDD:403870 27/89 (30%)
ANK repeat 44..75 CDD:293786 10/30 (33%)
ANK 2 44..74 10/29 (34%)
ANK repeat 77..105 CDD:293786 9/30 (30%)
ANK 3 77..103 9/28 (32%)
Ank_2 82..>142 CDD:423045 14/62 (23%)
ANK 4 107..138 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.