| Sequence 1: | NP_650607.1 | Gene: | m-cup / 42076 | FlyBaseID: | FBgn0038488 | Length: | 702 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_940863.3 | Gene: | LONRF2 / 164832 | HGNCID: | 24788 | Length: | 754 | Species: | Homo sapiens |
| Alignment Length: | 356 | Identity: | 68/356 - (19%) |
|---|---|---|---|
| Similarity: | 111/356 - (31%) | Gaps: | 134/356 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 381 QSLLICERVLGLTHKDMLF--RLTFRGASYADSLQLQRCIDLWRFLLEVRVSNWSILH--FETCF 441
Fly 442 AAQALVRLMLDLHVQNSSHIRSDARA--RFVHQDKVLPRFEDVLGVFRTLSESAIVVKHLLLLRP 504
Fly 505 VFRRQQENYDRVMR-----C--------------------------LAHLIYLL-----INTVHT 533
Fly 534 EAQNKLICQA-------VHEAVV-------------------------VGNLRSASTADTML-HL 565
Fly 566 CASRLNVIKSGYITDDNFADKTVFPNADVIKLLIQCGVDVNTKNEAKSTPLHVACQPYNYDNEIV 630
Fly 631 HLLLKCGGDIDQPNRADKRPYDLIASNPTST 661 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| m-cup | NP_650607.1 | ANK repeat | 101..175 | CDD:293786 | |
| Ank_2 | <101..174 | CDD:289560 | |||
| ANK | 147..262 | CDD:238125 | |||
| Ank_2 | 149..239 | CDD:289560 | |||
| ANK repeat | 177..208 | CDD:293786 | |||
| ANK repeat | 210..239 | CDD:293786 | |||
| ANK repeat | 241..271 | CDD:293786 | |||
| Ank_4 | 244..294 | CDD:290365 | |||
| ANK | 591..>657 | CDD:238125 | 7/65 (11%) | ||
| Ank_2 | 591..>641 | CDD:289560 | 4/49 (8%) | ||
| ANK repeat | 611..641 | CDD:293786 | 2/29 (7%) | ||
| LONRF2 | NP_940863.3 | TPR 1 | 23..58 | ||
| TPR_16 | 27..92 | CDD:372602 | |||
| TPR 2 | 59..91 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 112..136 | ||||
| RING1-HC_LONFs | 143..174 | CDD:319427 | 9/40 (23%) | ||
| TPR 3 | 197..230 | 9/50 (18%) | |||
| TPR repeat | 200..225 | CDD:276809 | 6/31 (19%) | ||
| TPR repeat | 230..260 | CDD:276809 | 8/29 (28%) | ||
| TPR 4 | 231..264 | 8/32 (25%) | |||
| TPR repeat | 265..293 | CDD:276809 | 2/27 (7%) | ||
| TPR 5 | 266..298 | 3/31 (10%) | |||
| PEX10 | <380..489 | CDD:227861 | 12/84 (14%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 398..439 | 8/60 (13%) | |||
| RING2-HC_LONFs | 446..487 | CDD:319428 | |||
| TPR 6 | 447..483 | ||||
| RING-HC finger (C3HC4-type) | 449..486 | CDD:319428 | |||
| LON_substr_bdg | 538..738 | CDD:366967 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0508 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||