DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5265 and Chkb

DIOPT Version :9

Sequence 1:NP_650605.1 Gene:CG5265 / 42074 FlyBaseID:FBgn0038486 Length:643 Species:Drosophila melanogaster
Sequence 2:NP_031718.1 Gene:Chkb / 12651 MGIID:1328313 Length:394 Species:Mus musculus


Alignment Length:275 Identity:51/275 - (18%)
Similarity:83/275 - (30%) Gaps:103/275 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 SRD------NWAEAY----------EHLSNTPRNRVALKTIQNAMFTVSLDECTSPKEGRDAEEL 310
            |||      .|...|          |.||..|    ....:.|.:|..||.... |..|.:..|:
Mouse    42 SRDAQRRAYQWCREYLGGAWRRARPEELSVCP----VSGGLSNLLFRCSLPNHV-PSVGGEPREV 101

  Fly   311 ILTL----IHGKGSKCNSANRWMDKTIQLVVNPNGHVGFTYEHSPAEGQPIAMMMDYVVKKMKDD 371
            :|.|    :.|..|              ||:.                   ::|...:.::....
Mouse   102 LLRLYGAILQGVDS--------------LVLE-------------------SVMFAILAERSLGP 133

  Fly   372 PSYG---ECGSENFIPAKKIKFCDVSKCV----------------------EQWLIIAQKNVDKL 411
            ..||   |...|.::|::.:|..::...|                      .:||....:...|.
Mouse   134 QLYGVFPEGRLEQYLPSRPLKTQELRDPVLSGAIATRMARFHGMEMPFTKEPRWLFGTMERYLKQ 198

  Fly   412 VQDL------QMKVLKFDCYGKDFIKKQRL-----GPDSFVQMALQLAFFKLHYEPAA------- 458
            :|||      ||.:::......:....::|     .|..|....:|.....|..||.:       
Mouse   199 IQDLPSTSLPQMNLVEMYSLKDEMNSLRKLLDDTPSPVVFCHNDIQEGNILLLSEPDSDDNLMLV 263

  Fly   459 --QYESAHLRIFDGG 471
              :|.|.:.|.||.|
Mouse   264 DFEYSSYNYRGFDIG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5265NP_650605.1 Carn_acyltransf 49..623 CDD:279140 51/275 (19%)
ChkbNP_031718.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 51/275 (19%)
PLN02236 57..391 CDD:177880 46/260 (18%)
ChoK_euk 73..385 CDD:270705 43/244 (18%)
Substrate binding. /evidence=ECO:0000250 77..79 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.918296 Normalized mean entropy S1806
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.