DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5265 and CHKB

DIOPT Version :9

Sequence 1:NP_650605.1 Gene:CG5265 / 42074 FlyBaseID:FBgn0038486 Length:643 Species:Drosophila melanogaster
Sequence 2:NP_005189.2 Gene:CHKB / 1120 HGNCID:1938 Length:395 Species:Homo sapiens


Alignment Length:395 Identity:74/395 - (18%)
Similarity:119/395 - (30%) Gaps:144/395 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 SRDNWAEAY----EHLSNTPRNRVALKTIQ---------NAMFTVSLDECTSPKEGRDAEELILT 313
            |||....||    |:|....| ||..:.::         |.:|..||.: ..|..|.:..|::|.
Human    42 SRDAERRAYQWCREYLGGAWR-RVQPEELRVYPVSGGLSNLLFRCSLPD-HLPSVGEEPREVLLR 104

  Fly   314 L----IHGKGSKCNSANRWMDKTIQLVVNPNGHVGFTYEHSPAEGQPIAMMMDYVVKKMKDDPSY 374
            |    :.|..|              ||:.                   ::|...:.::......|
Human   105 LYGAILQGVDS--------------LVLE-------------------SVMFAILAERSLGPQLY 136

  Fly   375 G---ECGSENFIPAKKIKFCDVSKCV----------------------EQWLIIAQKNVDKLVQD 414
            |   |...|.:||::.:|..::.:.|                      ..||....:...|.:||
Human   137 GVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQD 201

  Fly   415 L------QMKVLKFDCYGKDFIKKQRLG-----------PDSFVQMALQLAFFKLHYEPA----- 457
            |      :|.:|:.      :..|..:|           |..|....:|.....|..||.     
Human   202 LPPTGLPEMNLLEM------YSLKDEMGNLRKLLESTPSPVVFCHNDIQEGNILLLSEPENADSL 260

  Fly   458 ----AQYESAHLRIFDGGR--TETIRSCSNESLAF--------------CHAMDDVSASA----- 497
                .:|.|.:.|.||.|.  .|.:...::|...|              .|.:....|.|     
Human   261 MLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGET 325

  Fly   498 --QERASKIRE---------AVMCHQMYAKLALLGKGVDRHLFGLKLMAVENCLPVPEFFSSPGY 551
              ||...|:.|         |:..|..:...::|...:....||....|...   ...:|...|.
Human   326 LSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSR---FQFYFQQKGQ 387

  Fly   552 VKSTH 556
            :.|.|
Human   388 LTSVH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5265NP_650605.1 Carn_acyltransf 49..623 CDD:279140 74/395 (19%)
CHKBNP_005189.2 PLN02236 57..388 CDD:177880 66/374 (18%)
ChoK_euk 69..385 CDD:270705 61/358 (17%)
Substrate binding. /evidence=ECO:0000250 77..79 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.918296 Normalized mean entropy S1806
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.