DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5265 and LOC101884918

DIOPT Version :9

Sequence 1:NP_650605.1 Gene:CG5265 / 42074 FlyBaseID:FBgn0038486 Length:643 Species:Drosophila melanogaster
Sequence 2:XP_005173070.2 Gene:LOC101884918 / 101884918 -ID:- Length:123 Species:Danio rerio


Alignment Length:108 Identity:44/108 - (40%)
Similarity:66/108 - (61%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 ALLGKGVDRHLFGLKLMAVENCLPVPEFFSSPGYVKSTHFRMSTSQVATKYDAFMGYGPSVEDGY 582
            |:.|.|:|.||.||:.||.:..:..|:.||...|..|.||.:|||||.|:.:.|..|||.|.|||
Zfish     9 AVTGNGMDNHLLGLREMARQMEMQTPDIFSDETYKISNHFILSTSQVPTEMEMFCCYGPVVPDGY 73

  Fly   583 ACCYNPREHDIILAISAWRHCQATDHQKIAKALAQSFAEMKDV 625
            ..||||:...|:.::|::|..:.|...::|:.|..:..:|||:
Zfish    74 GVCYNPQSDHIVFSVSSFRENKETCSDRLAEELQVALLDMKDL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5265NP_650605.1 Carn_acyltransf 49..623 CDD:279140 41/104 (39%)
LOC101884918XP_005173070.2 Carn_acyltransf <8..114 CDD:279140 41/104 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D167256at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.