DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and TMPRSS5

DIOPT Version :10

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:256 Identity:78/256 - (30%)
Similarity:126/256 - (49%) Gaps:37/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCT---RGRQATAFRVLTGTQ 89
            :|||||:..|.|..|:|.|: .:|. .|:|||:::..||::|||||.   |..:.:::||..|..
Human   216 SRIVGGQSVAPGRWPWQASV-ALGF-RHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLV 278

  Fly    90 D-----LHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVEL--DHEALVPG 147
            .     .||..    ..:||:.|..|:.:.:..|:|||.|..::.|.:....|.|  ..:....|
Human   279 SHSAVRPHQGA----LVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKG 339

  Fly   148 SRLLLTGWG----TLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRG-AC 207
            ||..::|||    :.:...|:   ||...|.....:.|.::...|..:....:|.....||. ||
Human   340 SRCWVSGWGHTHPSHTYSSDM---LQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRADAC 401

  Fly   208 HGDSGGPLV----HNGKLVALVNWGLPCAK-GYPDAHASISYYHDFIRTHLSLSKTDSSED 263
            .||||||||    ...:||.:|:||..||: .:|..:|.::.:.|:|.        |:::|
Human   402 QGDSGGPLVCPDGDTWRLVGVVSWGRGCAEPNHPGVYAKVAEFLDWIH--------DTAQD 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 75/239 (31%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:464747
Tryp_SPc 217..448 CDD:214473 75/239 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.