DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Prss55

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:265 Identity:80/265 - (30%)
Similarity:121/265 - (45%) Gaps:47/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAH 72
            |.:.:|....:.||..:...:||:.|:||..|..|:|:|:|  .|..|.|||:|:.|.||:|.||
Mouse    39 LCIASSECGVRPLYDSRIQYSRIIEGQEAELGEFPWQVSIQ--ESDHHFCGGSILSEWWILTVAH 101

  Fly    73 CTRGRQ--ATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQ 135
            |...::  .|..||..||.||..:..:... ..|:.|..:......||||||.|.:.:.|:..|.
Mouse   102 CFYAQELSPTDLRVRVGTNDLTTSPVELEV-TTIIRHKGFKRLNMDNDIALLLLAKPLTFNELTV 165

  Fly   136 PVELD--------HEALVPGSRLLLTGWGTL------SLGGD---VPARLQSLEVNYVPFEQCRA 183
            |:.|.        ||..|       .|||..      |:..|   ||.|:       :.:|:|..
Mouse   166 PICLPLWPAPPSWHECWV-------AGWGVTNSTDKESMSTDLMKVPMRI-------IEWEECLQ 216

  Fly   184 AHDNSTRVDIGHVC-TFNDKGRGACHGDSGGPLV------HNGKLVALVNWGLPCA-KGYPDAHA 240
            ...:.|   ...:| ::.::...||.||||||||      .....|.:::||..|. ||:|..:.
Mouse   217 MFPSLT---TNMLCASYGNESYDACQGDSGGPLVCTTDPGSRWYQVGIISWGKSCGKKGFPGIYT 278

  Fly   241 SISYY 245
            .::.|
Mouse   279 VLAKY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 76/244 (31%)
Tryp_SPc 30..252 CDD:238113 75/243 (31%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.