DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Klk10

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:274 Identity:75/274 - (27%)
Similarity:123/274 - (44%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRI-VGGEEAAAGLAPYQISLQGIGSGAHS----CGGA 60
            ::.:||||::....||..:|.|...|:..: ..|.:......|:|:||      .|:    |.|.
Mouse    17 LVKLLLPLLMVQLWAAQALLLPGNATRVDLEASGAQCERDYHPWQVSL------FHNLQFQCAGV 75

  Fly    61 IIDERWIITAAHCTRGRQATAFRV------LTGTQDLHQNGSKYYYP------DRIVEHSNYAPR 113
            ::|:.|::|||||.|.:...| ||      |...:.|....|..::|      ..|:.|     |
Mouse    76 LVDQNWVLTAAHCWRNKPLRA-RVGDDHLLLFQKEQLRSTSSPVFHPKYQACSGPILPH-----R 134

  Fly   114 KYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRLLLTGWGT-LSLGGDVPARLQSLEVNYVP 177
            ...:|:.:|.|:..::..:...||:|......||....::|||| .|........|...:|..:.
Mouse   135 SDEHDLMMLKLSSPVMLTSNVHPVQLPFRCSQPGQECQVSGWGTSASRRVKYNRSLSCSKVTLLS 199

  Fly   178 FEQCRAAH----DNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGL-PC-AKGYP 236
            .:||...:    .||.      :|...|..:.:|..|||||||.:..|..:::||: || |..:|
Mouse   200 QKQCETFYPGVITNSM------ICAEADGNQDSCQSDSGGPLVCDDTLHGVLSWGIYPCGAAQHP 258

  Fly   237 DAHASISYYHDFIR 250
            ..::.|..|..:||
Mouse   259 SVYSEICKYTPWIR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 64/243 (26%)
Tryp_SPc 30..252 CDD:238113 66/245 (27%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 64/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.