DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and TMPRSS3

DIOPT Version :10

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:74 Identity:19/74 - (25%)
Similarity:33/74 - (44%) Gaps:11/74 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IDGIPQSGVSILKQLKILSLPDNLIEYVQDNAFLSYHSRDSLLKLDLSANNLTAIHPTGLLGLEN 184
            :||      |:...|.|..:..:.:.:..:..||:...:|.:  ...|:|....:.|.||..:: 
Human    33 LDG------SVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGV--TSQSSNKERIVFPDGLYSMK- 88

  Fly   185 LSQLSLDKN 193
            ||||.  ||
Human    89 LSQLK--KN 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 19/74 (26%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060 10/25 (40%)
SRCR_2 112..210 CDD:464747
Tryp_SPc 216..444 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.