DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG17234

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:263 Identity:86/263 - (32%)
Similarity:121/263 - (46%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWI 67
            |:||.|...::...::       .:.||:|||.......|:|:|||..|.  |.|||:|..|..|
  Fly     7 LLLLALDFLSAGQVNR-------WEQRIIGGEPIGIEQVPWQVSLQYFGD--HVCGGSIYSENII 62

  Fly    68 ITAAHC----------TRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALL 122
            :|||||          .:|.|..|...||.:     ||:.......|: |..||.....||||::
  Fly    63 VTAAHCFFDEEGNRLDDQGYQVRAGSALTDS-----NGTLVDVAALII-HEEYAFDLNINDIAIV 121

  Fly   123 HLNESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGD----VPARLQSLEVNYVPFEQCRA 183
            .|:..:.|.:..||:.|......|.|..|::|||...:..|    .|..||.|.::......||.
  Fly   122 RLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL 186

  Fly   184 AHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCAKGYPDA--HASISYYH 246
                   .|...:|. ...||.|||||||||||.|.:||.:|:||   .||...:  ..|:.|:.
  Fly   187 -------FDPSLLCA-GTYGRTACHGDSGGPLVVNKQLVGVVSWG---RKGCVSSAFFVSVPYFR 240

  Fly   247 DFI 249
            ::|
  Fly   241 EWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 81/235 (34%)
Tryp_SPc 30..252 CDD:238113 81/236 (34%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 81/235 (34%)
Tryp_SPc 27..243 CDD:238113 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.