DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG34171

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:297 Identity:66/297 - (22%)
Similarity:114/297 - (38%) Gaps:82/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLILLPLVLFTSSAASQI--LYPPQYTKNRIVGGEEAAAGLAPYQISLQ-----GIGSGAHSCGG 59
            ||:.:.|||..:....:|  .:.|.|:.            |:.|.:||:     ......|.|.|
  Fly     7 LLLKIALVLPKNITTIKINHYHEPTYSH------------LSSYLVSLRTRKYIHTPGDNHFCTG 59

  Fly    60 AIIDERWIITAAHCTRGRQ--------------ATAFRVLTGTQ---DLHQNGSKYYYPDRIVEH 107
            .|:..|.::|:|||...:.              |:.|:.....:   |:|          .::.|
  Fly    60 VILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIH----------NMIIH 114

  Fly   108 SNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVP---GSRLLLTGWGTLSLGGDVPARLQ 169
            . |..|...||||::.|.         :.|:||...|.|   |:..|..|....::||....|.|
  Fly   115 P-YYHRNQHNDIAIIKLK---------RYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQ 169

  Fly   170 S---------LEVNYVPFEQC--------RAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVH 217
            .         :.|...||::|        .|..:|.   |:  :|..:.: :..|..|.||||..
  Fly   170 RFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENE---DL--ICVKSTE-KQMCTTDFGGPLFC 228

  Fly   218 NGKLVALVNWGLPCAKGYPDAHASISYYHDFIRTHLS 254
            :|:|..:....:.|:...|...:.:|:|:.::...:|
  Fly   229 DGQLYGIALGSINCSSPDPVFFSDVSFYNSWVTKIIS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 57/261 (22%)
Tryp_SPc 30..252 CDD:238113 57/263 (22%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 59/268 (22%)
Tryp_SPc 38..263 CDD:304450 56/250 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.