DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and KLK10

DIOPT Version :10

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_002767.2 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:101 Identity:23/101 - (22%)
Similarity:34/101 - (33%) Gaps:27/101 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 QKKTSPVQRKLSIQNNP------------WRCDKDLMW--LRKWLRDNGDVTTAASNSPPAKCWT 466
            :|:|.  ..:|||::|.            .:.|.|..|  :.|:..|.|  |....|....    
Human    68 EKETK--SGRLSIRDNQKNHSFQVTMEMLRQNDTDTYWCGIEKFGTDRG--TRVKVNVYSV---- 124

  Fly   467 PSNLSGLDLRQTDSKLPHKTTKPPVDQFQYKNQQVT 502
                 |.|...|.::||..|.....|......|:.|
Human   125 -----GKDTMSTSNQLPWPTVDGSTDMVSSDLQKRT 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473
KLK10NP_002767.2 Tryp_SPc 49..272 CDD:238113 23/101 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.