DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and TMPRSS15

DIOPT Version :10

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001414985.1 Gene:TMPRSS15 / 5651 HGNCID:9490 Length:1064 Species:Homo sapiens


Alignment Length:146 Identity:30/146 - (20%)
Similarity:48/146 - (32%) Gaps:51/146 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 GIPQSGVSILKQLKILSLPDNLIEYVQDNAFLSYHSRDSLLKLDLSANNLTAIHPTGLLGLENLS 186
            |.|.:..|..::|:            ||.|....||.:....|.|.:..|.|.........:.|.
Human   234 GPPSATASAAERLR------------QDLAIQERHSLEMQGTLALVSQALEAAEHALQAQAQELE 286

  Fly   187 QLS------------------------LDKNLLSEIPSQALENIPSLEDLSLGVNRIHTISRNSL 227
            :|:                        ||:....::|.      |:.|:|..||.:.|.:     
Human   287 ELNRELRQCNLQQFIQQTGAALPPPPQLDRTSTQDLPP------PTREELLQGVPQSHIL----- 340

  Fly   228 PLPNLKSLSLEVNQIR 243
                :.|||.||..:|
Human   341 ----VSSLSPEVPPMR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 30/146 (21%)
TMPRSS15NP_001414985.1 None

Return to query results.
Submit another query.